HPA006474

TAF5 antibody from Sigma-Aldrich
TAF2D, TAFII100
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006474
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006474, RRID:AB_1080185
Product name
Anti-TAF5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006474
Antibody type
Polyclonal
Antigen
Transcription initiation factor TFIID subunit 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKRE
ANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPK
KKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSD
KLDKIMNMKETTK
Storage
-20C
Provider Type Product Number
- No reagents -