Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310276 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Retinol Binding Protein 1, Cellular (RBP1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RBP1 antibody: synthetic peptide directed towards the middle region of human RBP1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMT
TVSWD GDKLQCVQKG- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Biochemical properties of purified human retinol dehydrogenase 12 (RDH12): catalytic efficiency toward retinoids and C9 aldehydes and effects of cellular retinol-binding protein type I (CRBPI) and cellular retinaldehyde-binding protein (CRALBP) on the oxidation and reduction of retinoids.
Belyaeva OV, Korkina OV, Stetsenko AV, Kim T, Nelson PS, Kedishvili NY
Biochemistry 2005 May 10;44(18):7035-47
Biochemistry 2005 May 10;44(18):7035-47
No comments: Submit comment
No validations: Submit validation data