HPA006214

MTA2 antibody from Atlas Antibodies
MTA1-L1, MTA1L1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA006214
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006214, RRID:AB_888609
Product name
Anti-MTA2
Provider product page
Atlas Antibodies - HPA006214
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQA
PLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYE
TMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNP
ADAPNPVVFVATKDTRALRKALTHLEMRRAARRPN
LPLKVKPT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -