HPA006214

MTA2 antibody from Sigma-Aldrich
MTA1-L1, MTA1L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006214
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006214, RRID:AB_1079421
Product name
Anti-MTA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006214
Antibody type
Polyclonal
Antigen
Metastasis-associated protein MTA2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQA
PLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYE
TMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNP
ADAPNPVVFVATKDTRALRKALTHLEMRRAARRPN
LPLKVKPT
Storage
-20C
Provider Type Product Number
- No reagents -