HPA021790

EXOSC2 antibody from Sigma-Aldrich
hRrp4p, p7, RRP4, Rrp4p
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021790
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021790, RRID:AB_1848320
Product name
Anti-EXOSC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021790
Antibody type
Polyclonal
Antigen
Exosome complex exonuclease RRP4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSL
ADREVISRLRNCIISLVTQRMMLYDTSILYCYEAS
LPHQIKDILKPEIMEEIVMETR
Storage
-20C
Provider Type Product Number
- No reagents -