Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108251 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mohawk Homeobox (MKX) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MKX antibody: synthetic peptide directed towards the middle region of human MKX.
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNHS
GSFSSNEFEEELVSP- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Mohawk is a novel homeobox gene expressed in the developing mouse embryo.
Anderson DM, Arredondo J, Hahn K, Valente G, Martin JF, Wilson-Rawls J, Rawls A
Developmental dynamics : an official publication of the American Association of Anatomists 2006 Mar;235(3):792-801
Developmental dynamics : an official publication of the American Association of Anatomists 2006 Mar;235(3):792-801
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; WB Suggested Anti-MKX Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate; MKX antibody - middle region (AP42063PU-N) in Human Jurkat cells using Western Blot