Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309626 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mohawk Homeobox (MKX) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MKX antibody: synthetic peptide directed towards the middle region of human MKX
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNHS
GSFSS NEFEEELVSP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Endogenous bone morphogenetic protein antagonists regulate mammalian neural crest generation and survival.
Mohawk is a novel homeobox gene expressed in the developing mouse embryo.
Anderson RM, Stottmann RW, Choi M, Klingensmith J
Developmental dynamics : an official publication of the American Association of Anatomists 2006 Sep;235(9):2507-20
Developmental dynamics : an official publication of the American Association of Anatomists 2006 Sep;235(9):2507-20
Mohawk is a novel homeobox gene expressed in the developing mouse embryo.
Anderson DM, Arredondo J, Hahn K, Valente G, Martin JF, Wilson-Rawls J, Rawls A
Developmental dynamics : an official publication of the American Association of Anatomists 2006 Mar;235(3):792-801
Developmental dynamics : an official publication of the American Association of Anatomists 2006 Mar;235(3):792-801
No comments: Submit comment
No validations: Submit validation data