HPA006927

MKX antibody from Sigma-Aldrich
C10orf48, IRXL1, MGC39616
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006927
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006927, RRID:AB_1853981
Product name
Anti-MKX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006927
Antibody type
Polyclonal
Antigen
Homeobox protein Mohawk recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTRQRNHSGSFSSNEFEEELVSPSSSETEGNFVYR
TDTLENGSNKGESAANRKGPSKDDTYWKEINAAMA
LTNLAQGKDKLQGTTSCIIQKSSHIAEVKTVKVP
Storage
-20C
Provider Type Product Number
- No reagents -