Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 20-272-192954 - Provider product page

- Provider
- GenWay
- Product name
- Integrin alpha 3a [29A3]
- Antibody type
- Monoclonal
- Antigen
- Synthetic peptide: C-RTRALYEAKRQKAEMKSQPSETERLTDDY conjugated to KLH.
- Description
- Protein G affinity purified.
- Reactivity
- Human
- Host
- Mouse
- Isotype
- IgG
- Vial size
- 0.1 mg
- Storage
- Keep as concentrated solution. Store at 4C short term. For extended storage aliquot and store at -20C or below. Avoid freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data