Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405613 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 25, Member 36 (SLC25A36) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC25A36 antibody: synthetic peptide directed towards the N terminal of human SLC25A36
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKV
ILEKE GPRSLFRGLG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A human protein-protein interaction network: a resource for annotating the proteome.
Stelzl U, Worm U, Lalowski M, Haenig C, Brembeck FH, Goehler H, Stroedicke M, Zenkner M, Schoenherr A, Koeppen S, Timm J, Mintzlaff S, Abraham C, Bock N, Kietzmann S, Goedde A, Toksöz E, Droege A, Krobitsch S, Korn B, Birchmeier W, Lehrach H, Wanker EE
Cell 2005 Sep 23;122(6):957-68
Cell 2005 Sep 23;122(6):957-68
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting