Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA022817 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA022817, RRID:AB_1853974
- Product name
- Anti-MKLN1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYL
FGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHC
KYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHS
DP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Characterization of the novel interaction between muskelin and TBX20, a critical cardiogenic transcription factor.
Debenedittis P, Harmelink C, Chen Y, Wang Q, Jiao K
Biochemical and biophysical research communications 2011 Jun 3;409(2):338-43
Biochemical and biophysical research communications 2011 Jun 3;409(2):338-43
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN