WH0284312M2

ZSCAN1 antibody from Sigma-Aldrich
FLJ33779, ZNF915
ELISA
Recommended by provider

Antibody data

Product number
WH0284312M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0284312M2, RRID:AB_1844323
Product name
Monoclonal Anti-ZSCAN1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0284312M2
Antibody type
Monoclonal
Antigen
ZSCAN1 (NP_872378, a.a. 315-408) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
REEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRK
KAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSV
CGKAFPWMVHLIDHQKLHTAHGH* (without G
ST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -