HPA017177

MED21 antibody from Sigma-Aldrich
SRB7, SURB7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017177
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017177, RRID:AB_1857665
Product name
Anti-MED21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017177
Antibody type
Polyclonal
Antigen
Mediator of RNA polymerase II transcription subunit 21 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINK
DQPANPTEEYAQLFAALIARTAKDIDVLIDSLPSE
ESTAALQAASLYKLEEENHEAATCLEDVVYRGDML
LEKIQSALADIAQSQ
Storage
-20C
Provider Type Product Number
- No reagents -