HPA018305

KCNQ4 antibody from MilliporeSigma / Merck KGaA
DFNA2, Kv7.4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018305
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018305, RRID:AB_1855556
Product name
Anti-KCNQ4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018305
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily KQT member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REKGDKGPSDAEVVDEISMMGRVVKVEKQVQSIEH
KLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITS
DYHSPVDHEDISVSAQTLSISRSV
Storage
-20C
Provider Type Product Number
- No reagents -