HPA061884

PMCH antibody from Atlas Antibodies
MCH

Antibody data

Product number
HPA061884
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA061884, RRID:AB_2684632
Product name
Anti-PMCH
Provider product page
Atlas Antibodies - HPA061884
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KGSVAFPAENGVQNTESTQEKREIGDEENSAKFPI
GRRDFDMLRCMLGRVYRPCW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -