AV13054

PMCH antibody from Sigma-Aldrich
MCH
No application information provided.

Antibody data

Product number
AV13054
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV13054, RRID:AB_1855485
Product name
Anti-PMCH antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV13054
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human PMCH with an internal ID of P01390.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
DMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDE
SSFMNEEENKVSKNT
Storage
-20C
Provider Type Product Number
- No reagents -