H00060412-M06
antibody from Abnova Corporation
Targeting: EXOC4
KIAA1699, MGC27170, SEC8, SEC8L1, Sec8p
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00060412-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00060412-M06, RRID:AB_606205
- Product name
- EXOC4 monoclonal antibody (M06), clone 4F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EXOC4.
- Antigen sequence
MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSD
DVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELT
TAIRTYQSITERITNSRNKIKQVKENLLSCKMLLH
CKRD- Isotype
- IgG
- Antibody clone number
- 4F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Exocyst subunits are involved in isoproterenol-induced amylase release from rat parotid acinar cells.
Imai A, Yoshie S, Haga-Tsujimura M, Nashida T, Shimomura H
European journal of oral sciences 2012 Apr;120(2):123-31
European journal of oral sciences 2012 Apr;120(2):123-31
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EXOC4 monoclonal antibody (M06), clone 4F1. Western Blot analysis of EXOC4 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EXOC4 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol