Antibody data

Product number
H00008467-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008467-M02, RRID:AB_1112250
Product name
SMARCA5 monoclonal antibody (M02), clone 3F4
Provider product page
Abnova Corporation - H00008467-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SMARCA5.
Antigen sequence
EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFE
YLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIK
KDEKQNLLSVGDYRHRRTE
Isotype
IgG
Antibody clone number
3F4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -