AV30031

SMARCA5 antibody from Sigma-Aldrich
hISWI, hSNF2H, ISWI
No application information provided.

Antibody data

Product number
AV30031
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV30031, RRID:AB_1857267
Product name
Anti-SMARCA5 (AB2) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV30031
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human SMARCA5 with an internal ID of H00207
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPEGVAAQAVASAVSAGPADAEMEEIFDDASPGKQ
KEIQEPDPTYEEKMQ
Storage
-20C
Provider Type Product Number
- No reagents -