HPA008751

SMARCA5 antibody from Sigma-Aldrich
hISWI, hSNF2H, ISWI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008751
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008751, RRID:AB_1857268
Product name
Anti-SMARCA5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008751
Antibody type
Polyclonal
Antigen
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGG
PEGVAAQAVASAASAGPADAEMEEIFDDASPGKQK
EIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFI
QPA
Storage
-20C
Provider Type Product Number
- No reagents -