HPA024356

CERS3 antibody from Atlas Antibodies
LASS3, MGC27091
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024356
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024356, RRID:AB_1852721
Product name
Anti-CERS3
Provider product page
Atlas Antibodies - HPA024356
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGKE
MDCLKNGLGAERHLIPNGQH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -