HPA006092

CERS3 antibody from Sigma-Aldrich
LASS3, MGC27091
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006092
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006092, RRID:AB_1079236
Product name
Anti-LASS3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006092
Antibody type
Polyclonal
Antigen
LAG1 longevity assurance homolog 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQ
PLQTDIYGLAKKCNLTERQVERWFRSR
Storage
-20C
Provider Type Product Number
- No reagents -