HPA024356

CERS3 antibody from Sigma-Aldrich
LASS3, MGC27091
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024356
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024356, RRID:AB_1852721
Product name
Anti-LASS3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024356
Antibody type
Polyclonal
Antigen
LAG1 longevity assurance homolog 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGKE
MDCLKNGLGAERHLIPNGQH
Storage
-20C
Provider Type Product Number
- No reagents -