Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029217 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-ASCL1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGV
LSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLS
PEEQELLDFTNWF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Stat3 defines three populations of müller glia and is required for initiating maximal müller glia proliferation in the regenerating zebrafish retina
Nelson C, Gorsuch R, Bailey T, Ackerman K, Kassen S, Hyde D
Journal of Comparative Neurology 2012;520(18):4294-4311
Journal of Comparative Neurology 2012;520(18):4294-4311
No comments: Submit comment
No validations: Submit validation data