H00136332-A01

LRGUK antibody from Abnova Corporation
CFAP246, FLJ32786
No application information provided.

Antibody data

Product number
H00136332-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00136332-A01, RRID:AB_563245
Product name
FLJ32786 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00136332-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant FLJ32786.
Antigen sequence
YFKPPFGPYPEKSGKDSLVSMKCSLFRFCPWSKEL
PFQPPEGSISSHLGSGASDSETEETRKALPIQSFS
HEKESHQHRQHSVPVISRPGSNVKPTLPPIPQGRR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -