HPA021275

LRGUK antibody from Sigma-Aldrich
CFAP246, FLJ32786
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021275
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021275, RRID:AB_1848882
Product name
Anti-LRGUK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021275
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and guanylate kinase domain-containing protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVPMNKEKYEGYLRRKGLFSRAEIEFAVSRVDLYI
KINQNFPGYFDEVINADDLDVAYQKLSQLIREYLG
LTEEPAKSLATTADVKTSHLKPEA
Storage
-20C
Provider Type Product Number
- No reagents -