HPA021275

LRGUK antibody from MilliporeSigma / Merck KGaA
CFAP246, FLJ32786
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021275
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021275, RRID:AB_1848882
Product name
Anti-LRGUK antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021275
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and guanylate kinase domain-containing protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVPMNKEKYEGYLRRKGLFSRAEIEFAVSRVDLYI
KINQNFPGYFDEVINADDLDVAYQKLSQLIREYLG
LTEEPAKSLATTADVKTSHLKPEA
Storage
-20C
Provider Type Product Number
- No reagents -