HPA029505

LRGUK antibody from MilliporeSigma / Merck KGaA
CFAP246, FLJ32786
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029505
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029505, RRID:AB_10599606
Product name
Anti-LRGUK antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029505
Antibody type
Polyclonal
Antigen
leucine-rich repeats and guanylate kinase domain containing recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNMGDFLHSTDRNYLIKFWAKLSAKKTPAERDSIH
RQHEAARQALMGRIRPDHTLLFQRGPVPAPLTSGL
HYYTTLEELWKSFDLCEDYFKPPFG
Storage
-20C
Provider Type Product Number
- No reagents -