HPA026871

antibody from Atlas Antibodies

Targeting: STAB2 DKFZP434E0321, FEEL-2, FELL, HARE, SCARH1, STAB-2

Antibody data

Submit

Validation data

Product number: HPA026871 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA026871, RRID:AB_1857536
Product name: Anti-STAB2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VVLEEKLLKNDLHNGMHRETMLGFSYFLSFFLHND QLYVNEAPINYTNVATDKGVIHGLGKVLEIQKNRC DNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKRRC IYTSYFMGRRTLFIGCQPKCVRTVITR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

STAB2 protein structure - HPA026871 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human spleen and cerebral cortex tissues using HPA026871 antibody. Corresponding STAB2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows distinct positivity in sinusoid endothelium.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in endothelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in hepatic sinusoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in endothelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Sample type: HUMAN