HPA026871

STAB2 antibody from Sigma-Aldrich
DKFZP434E0321, FEEL-2, FELL, HARE, SCARH1, STAB-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026871
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026871, RRID:AB_1857536
Product name
Anti-STAB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026871
Antibody type
Polyclonal
Antigen
Stabilin-2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVLEEKLLKNDLHNGMHRETMLGFSYFLSFFLHND
QLYVNEAPINYTNVATDKGVIHGLGKVLEIQKNRC
DNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKRRC
IYTSYFMGRRTLFIGCQPKCVRTVITR
Storage
-20C
Provider Type Product Number
- No reagents -