Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008021-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008021-A01, RRID:AB_462740
- Product name
- NUP214 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant NUP214.
- Antigen sequence
MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELP
KERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQ
NKPGDDPNKIVDKVQGLLVPMKFPIHH- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Oxidative stress inhibits nuclear protein export by multiple mechanisms that target FG nucleoporins and Crm1.
The N-terminal domain of the mammalian nucleoporin p62 interacts with other nucleoporins of the FXFG family during interphase.
Crampton N, Kodiha M, Shrivastava S, Umar R, Stochaj U
Molecular biology of the cell 2009 Dec;20(24):5106-16
Molecular biology of the cell 2009 Dec;20(24):5106-16
The N-terminal domain of the mammalian nucleoporin p62 interacts with other nucleoporins of the FXFG family during interphase.
Stochaj U, BaĆski P, Kodiha M, Matusiewicz N
Experimental cell research 2006 Aug 1;312(13):2490-9
Experimental cell research 2006 Aug 1;312(13):2490-9
No comments: Submit comment
No validations: Submit validation data