HPA018404

NUP214 antibody from Sigma-Aldrich
CAIN, CAN, D9S46E, N214
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018404
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018404, RRID:AB_1854716
Product name
Anti-NUP214 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018404
Antibody type
Polyclonal
Antigen
Nuclear pore complex protein Nup214 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELEELKARTSKACFQVGTSEEMKMLRTESDDLHTF
LLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQ
NERNRDSG
Storage
-20C
Provider Type Product Number
- No reagents -