HPA006144

ZNF18 antibody from Sigma-Aldrich
HDSG1, KOX11, Zfp535, ZKSCAN6, ZNF535, ZSCAN38
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006144
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006144, RRID:AB_1080683
Product name
Anti-ZNF18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006144
Antibody type
Polyclonal
Antigen
Zinc finger protein 18 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISIQVLGQDILSEKMESPSCQVGEVEPHLEVVPQE
LGLENSSSGPGELLSHIVKEESDTEAELALAASQP
ARLEERLIRDQDLGASLLPAAPQEQWRQLDSTQKE
QYWDLMLETYGKMVSGAGISHPKSDLTNS
Storage
-20C
Provider Type Product Number
- No reagents -