Antibody data

Product number
ABIN183949
Provider
antibodies-online
Product name
anti-Neuro-Oncological Ventral Antigen 2 (NOVA2) (N-Term) antibody
Provider product page
antibodies-online - ABIN183949
Antibody type
Polyclonal
Antigen
The immunogen for anti-NOVA2 antibody: synthetic peptide directed towards the N terminal of human NOVA2
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Zebrafish
Host
Rabbit
Antigen sequence
MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFL
KVLIP SYAAGSIIGK
Epitope
N-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -