Antibody data

Product number
ABIN183950
Provider
antibodies-online
Product name
anti-Neuro-Oncological Ventral Antigen 2 (NOVA2) (Middle Region) antibody
Provider product page
antibodies-online - ABIN183950
Antibody type
Polyclonal
Antigen
The immunogen for anti-NOVA2 antibody: synthetic peptide directed towards the middle region of human NOVA2
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Canine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAG
PVANS NPTGSPYASP
Epitope
Middle Region
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -