AV40400

NOVA2 antibody from Sigma-Aldrich
ANOVA, NOVA3
No application information provided.

Antibody data

Product number
AV40400
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV40400, RRID:AB_1854572
Product name
Anti-NOVA2 (AB2) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV40400
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human NOVA2 with an internal ID of P22830
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
VTVSGEPEQVHKAVSAIVQKVQEDPQSSSCLNISY
ANVAGPVANSNPTGS
Storage
-20C
Provider Type Product Number
- No reagents -