H00008993-B03

PGLYRP1 antibody from Abnova Corporation
PGLYRP, PGRP, PGRP-S, PGRPS, TAG7, TNFSF3L

Antibody data

Product number
H00008993-B03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008993-B03, RRID:AB_1578676
Product name
PGLYRP1 MaxPab mouse polyclonal antibody (B03)
Provider product page
Abnova Corporation - H00008993-B03
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PGLYRP1 protein.
Antigen sequence
MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVP
RNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTP
ASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLV
YEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVP
TPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQR
TLSPGNQLYHLIQNWPHYRSP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -