HPA006104

antibody from Atlas Antibodies

Targeting: KAT6B Morf, MOZ2, MYST4, qkf, querkopf, ZC2HC6B

Antibody data

Submit

Validation data

Product number: HPA006104 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA006104, RRID:AB_1079445
Product name: Anti-KAT6B
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KPVLRKAFQHQPGKKRQTEEEEGKDNHCFKNADPC RNNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRG LSKWRQNKERKTGFKLNLYTPPETPMEPDEQVTVE EQKETSEGKTSPSPIRIEEEVKETGEAL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

KAT6B protein structure - HPA006104 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and pancreas tissues using HPA006104 antibody. Corresponding KAT6B RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows very weak nuclear positivity in exocrine glandular cells.
Sample type: HUMAN