ABIN183747

KAT6B antibody from antibodies-online
Morf, MOZ2, MYST4, qkf, querkopf, ZC2HC6B
Western blot
Data presented on provider website

Antibody data

Product number
ABIN183747
Provider
antibodies-online
Product name
anti-K(lysine) Acetyltransferase 6B (KAT6B) (N-Term) antibody
Provider product page
antibodies-online - ABIN183747
Antibody type
Polyclonal
Antigen
The immunogen for anti-MYST4 antibody: synthetic peptide directed towards the N terminal of human MYST4
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
Host
Rabbit
Antigen sequence
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHA
VSTSH GLDKKTVSEQ
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.