HPA006104

KAT6B antibody from MilliporeSigma / Merck KGaA
Morf, MOZ2, MYST4, qkf, querkopf, ZC2HC6B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006104
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006104, RRID:AB_1079445
Product name
Anti-MYST4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006104
Antibody type
Polyclonal
Antigen
Histone acetyltransferase MYST4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPVLRKAFQHQPGKKRQTEEEEGKDNHCFKNADPC
RNNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRG
LSKWRQNKERKTGFKLNLYTPPETPMEPDEQVTVE
EQKETSEGKTSPSPIRIEEEVKETGEAL
Storage
-20C
Provider Type Product Number
- No reagents -