Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107337 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-GATA Zinc Finger Domain Containing 1 (GATAD1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GATAD1 antibody: synthetic peptide directed towards the C terminal of human GATAD1.
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYI
WTHVGPTPAITIKES- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Isolation and characterization of beta- and gamma-crystallin genes from rat genomic cosmid libraries.
Moormann RJ, Jongbloed R, Schoenmakers JG
Gene 1984 Jul-Aug;29(1-2):1-9
Gene 1984 Jul-Aug;29(1-2):1-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human K562; WB Suggested Anti-GATAD1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: K562 cell lysate. GATAD1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells.; GATAD1 antibody - C-terminal region (AP42186PU-N) in Human K562 cells using Western Blot
