HPA006105

GATAD1 antibody from Sigma-Aldrich
FLJ22489, ODAG, RG083M05.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006105
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006105, RRID:AB_1078956
Product name
Anti-GATAD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006105
Antibody type
Polyclonal
Antigen
GATA zinc finger domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDE
QDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSP
RDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYF
KSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKESV
ANHL
Storage
-20C
Provider Type Product Number
- No reagents -