Antibody data

Product number
H00001101-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001101-A01, RRID:AB_489545
Product name
CHAD polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00001101-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant CHAD.
Antigen sequence
LDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPS
NFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKAS
RPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKK
AGRH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -