Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001101-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001101-M01, RRID:AB_530000
- Product name
- CHAD monoclonal antibody (M01), clone 8B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CHAD.
- Antigen sequence
LDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPS
NFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKAS
RPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKK
AGRH- Isotype
- IgG
- Antibody clone number
- 8B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Intervertebral disc regeneration: influence of growth factors on differentiation of human mesenchymal stem cells (hMSC).
Ehlicke F, Freimark D, Heil B, Dorresteijn A, Czermak P
The International journal of artificial organs 2010 Apr;33(4):244-52
The International journal of artificial organs 2010 Apr;33(4):244-52
No comments: Submit comment
No validations: Submit validation data