H00001101-M01

CHAD antibody from Abnova Corporation
SLRR4A
No application information provided.

Antibody data

Product number
H00001101-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001101-M01, RRID:AB_530000
Product name
CHAD monoclonal antibody (M01), clone 8B7
Provider product page
Abnova Corporation - H00001101-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CHAD.
Antigen sequence
LDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPS
NFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKAS
RPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKK
AGRH
Isotype
IgG
Antibody clone number
8B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -