HPA018241

CHAD antibody from Sigma-Aldrich
SLRR4A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018241
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018241, RRID:AB_1846612
Product name
Anti-CHAD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018241
Antibody type
Polyclonal
Antigen
Chondroadherin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRWLYLSENALSSLQPGALDDVENLAKFHVDRNQL
SSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSF
GRYLETLWLDNTNLEKFSDGAFLGVTT
Storage
-20C
Provider Type Product Number
- No reagents -