H00057016-A01
antibody from Abnova Corporation
Targeting: AKR1B10
AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057016-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057016-A01, RRID:AB_489361
- Product name
- AKR1B10 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant AKR1B10.
- Antigen sequence
VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLI
HWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SUOX is a promising diagnostic and prognostic biomarker for hepatocellular carcinoma.
Proteasome inhibitors MG-132 and bortezomib induce AKR1C1, AKR1C3, AKR1B1, and AKR1B10 in human colon cancer cell lines SW-480 and HT-29.
Proteomic identification of aldo-keto reductase AKR1B10 induction after treatment of colorectal cancer cells with the proteasome inhibitor bortezomib.
Jin GZ, Yu WL, Dong H, Zhou WP, Gu YJ, Yu H, Yu H, Lu XY, Xian ZH, Liu YK, Cong WM, Wu MC
Journal of hepatology 2013 Sep;59(3):510-7
Journal of hepatology 2013 Sep;59(3):510-7
Proteasome inhibitors MG-132 and bortezomib induce AKR1C1, AKR1C3, AKR1B1, and AKR1B10 in human colon cancer cell lines SW-480 and HT-29.
Ebert B, Kisiela M, Wsól V, Maser E
Chemico-biological interactions 2011 May 30;191(1-3):239-49
Chemico-biological interactions 2011 May 30;191(1-3):239-49
Proteomic identification of aldo-keto reductase AKR1B10 induction after treatment of colorectal cancer cells with the proteasome inhibitor bortezomib.
Loeffler-Ragg J, Mueller D, Gamerith G, Auer T, Skvortsov S, Sarg B, Skvortsova I, Schmitz KJ, Martin HJ, Krugmann J, Alakus H, Maser E, Menzel J, Hilbe W, Lindner H, Schmid KW, Zwierzina H
Molecular cancer therapeutics 2009 Jul;8(7):1995-2006
Molecular cancer therapeutics 2009 Jul;8(7):1995-2006
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AKR1B10 polyclonal antibody (A01), Lot # UOP11060207QCS1 Western Blot analysis of AKR1B10 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AKR1B10 polyclonal antibody (A01), Lot # UOP11060207QCS1. Western Blot analysis of AKR1B10 expression in NIH/3T3.