H00057016-B01

AKR1B10 antibody from Abnova Corporation
AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI

Antibody data

Product number
H00057016-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057016-B01, RRID:AB_1203945
Product name
AKR1B10 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00057016-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human AKR1B10 protein.
Antigen sequence
MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVA
IDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKR
EDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYL
DVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLD
AWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPG
LKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAY
SPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTA
AQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFK
LSDEEMATILSFNRNWRACNVLQSSHLEDYPFDAE
Y
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -