HPA020280

AKR1B10 antibody from Sigma-Aldrich
AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020280
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020280, RRID:AB_10602228
Product name
Anti-AKR1B10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020280
Antibody type
Polyclonal
Antigen
aldo-keto reductase family 1, member B10 (aldose reductase) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQG
FKSGDDLFPKDDKGNAIGGKAT
Storage
-20C
Provider Type Product Number
- No reagents -