HPA022436

RSAD1 antibody from Atlas Antibodies
FLJ11164, HemW
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022436
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022436, RRID:AB_2180789
Product name
Anti-RSAD1
Provider product page
Atlas Antibodies - HPA022436
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFG
ANKEVQELLERGLLQLDHRGLRCSWEGLAVLDSLL
LTLLP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -