HPA022436

RSAD1 antibody from Sigma-Aldrich
FLJ11164, HemW
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022436
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022436, RRID:AB_2180789
Product name
Anti-RSAD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022436
Antibody type
Polyclonal
Antigen
Radical S-adenosyl methionine domain-containing protein 1, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFG
ANKEVQELLERGLLQLDHRGLRCSWEGLAVLDSLL
LTLLP
Storage
-20C
Provider Type Product Number
- No reagents -