HPA023914

FAM78A antibody from Sigma-Aldrich
C9orf59, FLJ00024
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023914
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023914, RRID:AB_1848412
Product name
Anti-FAM78A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023914
Antibody type
Polyclonal
Antigen
Protein FAM78A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FCDCWPSLEIRALLYAMGCIQSIGGKARVFREGIT
VIDVKASIDPVPTSIDESSSVVLRYRTP
Storage
-20C
Provider Type Product Number
- No reagents -